PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN38604.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 335aa    MW: 38182 Da    PI: 8.4729
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN38604.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+ +++++G+g +W + ++++g++R++k+c++rw++yl
       KHN38604.1 14 RGPWSPEEDTRLKSYIEEHGTGgNWIALPQKLGLKRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding39.51.3e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g++++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
       KHN38604.1  69 GNFSEEEDNIICSLYVTIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      89*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.633962IPR017930Myb domain
SuperFamilySSF466895.01E-2711109IPR009057Homeodomain-like
SMARTSM007171.0E-121364IPR001005SANT/Myb domain
PfamPF002493.7E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-251569IPR009057Homeodomain-like
CDDcd001672.18E-91662No hitNo description
PROSITE profilePS5129422.07263117IPR017930Myb domain
SMARTSM007175.9E-1267115IPR001005SANT/Myb domain
PfamPF002492.3E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-2470117IPR009057Homeodomain-like
CDDcd001676.19E-870111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPE EDTRLKSYIE EHGTGGNWIA LPQKLGLKRC GKSCRLRWLN  60
YLRPNIKHGN FSEEEDNIIC SLYVTIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLLGK  120
QRKLEQQAQA RKVFNQKQQI KRESEDLMLP VGVTTRTPYW PEQQYSWPIP VANNASIQYS  180
NLNNNNQTSS FSKHFPNNIV TATTMNSQHS SRDISLTQNQ LHDLHPSTLM NMISTDTCHT  240
SNVFQGFVKL SSDFPCVNQQ QIDGTMRVFY GLETMDMATN GSTNTTSTES TSWGDINSLV  300
YSPLLVSDHE ACQQRIIMPQ DVTFEESSCF AMQRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525879.10.0PREDICTED: transcription factor RAX3-like
SwissprotQ9M2Y91e-84RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A0B2S2G90.0A0A0B2S2G9_GLYSO; Transcription factor RAX3
STRINGGLYMA05G23080.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.11e-75myb domain protein 84
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]